General Information

  • ID:  hor005221
  • Uniprot ID:  P69067(1-32)
  • Protein name:  Calcitonin-2
  • Gene name:  NA
  • Organism:  Oncorhynchus keta (Chum salmon) (Salmo keta)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP
  • Length:  32(1-32)
  • Propeptide:  CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP
  • Signal peptide:  NA
  • Modification:  T32 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45664
  • Structure ID:  AF-P69067-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P69067-F1.pdbhor005221_AF2.pdbhor005221_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 394002 Formula: C145H241N43O46S2
Absent amino acids: EIMWY Common amino acids: L
pI: 8.82 Basic residues: 4
Polar residues: 14 Hydrophobic residues: 9
Hydrophobicity: -17.5 Boman Index: -4139
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 82.19
Instability Index: 2987.81 Extinction Coefficient cystines: 125
Absorbance 280nm: 4.03

Literature

  • PubMed ID:  4508400
  • Title:  Synthesis of two natural salmon calcitonins.